RetrogeneDB ID: | retro_dnov_1786 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_30290:7562..7903(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP1S2 | ||
Ensembl ID: | ENSDNOG00000013888 | ||
Aliases: | None | ||
Description: | adaptor-related protein complex 1, sigma 2 subunit [Source:HGNC Symbol;Acc:560] |
Percent Identity: | 93.04 % |
Parental protein coverage: | 80.28 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | KKITRELVQTVLARKPKMCSFLEWR-DLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGS |
KKITRELVQTVLA.KPKMCSFLEW..DLKIVYKRYASLYFC.AIEDQDNELITLEIIH.YVELLDKYFGS | |
Retrocopy | KKITRELVQTVLAHKPKMCSFLEWQ<DLKIVYKRYASLYFCRAIEDQDNELITLEIIHHYVELLDKYFGS |
Parental | VCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQ |
VCELDIIFNFEKAYFILDEFLLGGEVQETSKK.VLKA.EQ.DLLQ | |
Retrocopy | VCELDIIFNFEKAYFILDEFLLGGEVQETSKKKVLKATEQVDLLQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 1 .94 RPM |
SRP012922_cerebellum | 0 .27 RPM | 23 .64 RPM |
SRP012922_heart | 0 .00 RPM | 6 .03 RPM |
SRP012922_kidney | 0 .00 RPM | 1 .37 RPM |
SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
SRP012922_lung | 0 .15 RPM | 3 .97 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 2 .77 RPM |
SRP012922_spleen | 0 .00 RPM | 6 .52 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000020420 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004393 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000013888 | 1 retrocopy |
retro_dnov_1786 ,
|
Homo sapiens | ENSG00000182287 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000014055 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017197 | 7 retrocopies | |
Otolemur garnettii | ENSOGAG00000011342 | 3 retrocopies | |
Procavia capensis | ENSPCAG00000000733 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000010218 | 1 retrocopy | |
Sorex araneus | ENSSARG00000000117 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000013119 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000012142 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000008517 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000008834 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000005290 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000007642 | 1 retrocopy |