RetrogeneDB ID: | retro_dnov_22 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_38593:50502..51051(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSDNOG00000019290 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FOXR1 | ||
Ensembl ID: | ENSDNOG00000009414 | ||
Aliases: | None | ||
Description: | forkhead box R1 [Source:HGNC Symbol;Acc:29980] |
Percent Identity: | 52.9 % |
Parental protein coverage: | 51.94 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ARYRLRLVKPPKLPLEKKPRPDRDGPDIEPNLWMWVNSNIVYPPGKLEAAAR---EALTSTL-CPQPPPK |
A.Y.L.....PKLPLE..P.PD.DGPD..PNLWMWVN.NIV......EA..R.....LTS.L...QPP.K | |
Retrocopy | AKYQLQIMESPKLPLERRPNPDKDGPDYDPNLWMWVNPNIVCSLSIQEAPNRNKEKDLTSVLPSLQPPSK |
Parental | EEESSCPKVTVVEALPPCSSEESPPGKWFASSPSDWELTEEEEAENHDDSSFGALSPPHKKGSLQSRR |
.EE..C...TVVE.LP..SSE..P..K.F.S.PSDWELT.EE.AE..D..S..AL..P.K....QS.. | |
Retrocopy | DEEFTCLEATVVESLPSSSSEQYPLQKRFTSFPSDWELT-EEKAEEQDGNSSAALRSPDKGKCYQSQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 0 .00 RPM |
SRP012922_cerebellum | 0 .00 RPM | 0 .96 RPM |
SRP012922_heart | 0 .00 RPM | 3 .25 RPM |
SRP012922_kidney | 0 .00 RPM | 0 .82 RPM |
SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
SRP012922_lung | 0 .00 RPM | 0 .00 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 3 .63 RPM |
SRP012922_spleen | 0 .00 RPM | 0 .11 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000053 | 1 retrocopy | |
Bos taurus | ENSBTAG00000014606 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000012417 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000013656 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009414 | 1 retrocopy |
retro_dnov_22 ,
|
Dipodomys ordii | ENSDORG00000001960 | 1 retrocopy | |
Homo sapiens | ENSG00000176302 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000002680 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000022722 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000004890 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007376 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000007258 | 1 retrocopy | |
Procavia capensis | ENSPCAG00000010132 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000003947 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000004358 | 1 retrocopy | |
Sorex araneus | ENSSARG00000011319 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000015101 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000014321 | 1 retrocopy |