RetrogeneDB ID: | retro_dnov_777 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_106393:4164..4538(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | APOPT1 | ||
Ensembl ID: | ENSDNOG00000019553 | ||
Aliases: | None | ||
Description: | apoptogenic 1, mitochondrial [Source:HGNC Symbol;Acc:20492] |
Percent Identity: | 71.65 % |
Parental protein coverage: | 66.84 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | REAAPSRVSSSHHDWIGPPD-KYSNLRPVQFYIPENESPLERKLRELRQETQEWNQRFWTNQNLTFSKEK |
R.A..SR.SSS.H.W.GP...KYSNL.PVQFYIPENESPL..KLRELR.ETQEW.Q.F.....LTFSKEK | |
Retrocopy | RDAVLSRDSSSCHHWVGPSE<KYSNL*PVQFYIPENESPLQQKLRELR*ETQEWSQQFCAIRDLTFSKEK |
Parental | EEFIHS-RLKARGLGGSAGSGQKPTLNAEEMAEFYKEFLNKNFQKHMYYNRGWYKHN |
.EFIHS.R..ARGLG..AGSGQK.TL.AEE.AEFYKE.LNKN.QKHMY.NR..YK.N | |
Retrocopy | -EFIHSFRTEARGLGVRAGSGQKTTLKAEEIAEFYKECLNKNVQKHMY*NRDGYKRN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 6 .61 RPM |
SRP012922_cerebellum | 0 .00 RPM | 8 .39 RPM |
SRP012922_heart | 0 .00 RPM | 4 .64 RPM |
SRP012922_kidney | 0 .00 RPM | 4 .38 RPM |
SRP012922_liver | 0 .00 RPM | 2 .01 RPM |
SRP012922_lung | 0 .00 RPM | 3 .82 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 8 .48 RPM |
SRP012922_spleen | 0 .00 RPM | 4 .24 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000030884 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000019553 | 5 retrocopies | |
Erinaceus europaeus | ENSEEUG00000011728 | 1 retrocopy | |
Felis catus | ENSFCAG00000027939 | 3 retrocopies | |
Microcebus murinus | ENSMICG00000009792 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000002350 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000015416 | 1 retrocopy |