RetrogeneDB ID: | retro_ecab_716 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 3:56672232..56672433(+) | ||
| Located in intron of: | ENSECAG00000017827 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | HSPE1 | ||
| Ensembl ID: | ENSECAG00000026874 | ||
| Aliases: | None | ||
| Description: | heat shock 10kDa protein 1 (chaperonin 10) [Source:HGNC Symbol;Acc:5269] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | EKSQGKVLQATVVAVGAGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| .KSQ.KVLQ.TVVAV...S.GKGGEIQPVS..V.DK...PEYGG.KV.LDDKDYF.FR.GDILGKYVD | |
| Retrocopy | KKSQEKVLQSTVVAVDLSSNGKGGEIQPVSMYVRDKIF-PEYGGIKVALDDKDYFFFRGGDILGKYVD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 11 .92 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 32 .30 RPM |
| SRP021940_embryo | 0 .00 RPM | 44 .50 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 30 .31 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 17 .90 RPM |
| SRP021940_testis | 0 .00 RPM | 28 .01 RPM |