RetrogeneDB ID: | retro_rnor_2296 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 6:66579390..66579600(+) | ||
| Located in intron of: | ENSRNOG00000023116 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Hspe1 | ||
| Ensembl ID: | ENSRNOG00000014868 | ||
| Aliases: | Hspe1, Cpn10 | ||
| Description: | 10 kDa heat shock protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P26772] |
| Percent Identity: | 55.71 % |
| Parental protein coverage: | 68.63 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | LPEKSQGKVLQATVVAVGSGGKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| L...SQGK.LQ.T..AV.S..KGKGG...PV...VG.KV.L..YG.T.V.L....YF.FRDGD...KYVD | |
| Retrocopy | LXXXSQGKALQVTLIAVWSNEKGKGGDSPPVPATVGHKVFLLQYGVTEVFLSGEGYFSFRDGDNYEKYVD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 30 .34 RPM |
| SRP017611_kidney | 0 .00 RPM | 113 .47 RPM |
| SRP017611_liver | 0 .00 RPM | 45 .72 RPM |