RetrogeneDB ID: | retro_dnov_524 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_5687:182366..182531(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | HSPE1 | ||
Ensembl ID: | ENSDNOG00000013246 | ||
Aliases: | None | ||
Description: | heat shock 10kDa protein 1 (chaperonin 10) [Source:HGNC Symbol;Acc:5269] |
Percent Identity: | 80.36 % |
Parental protein coverage: | 55.45 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | TVVAVGSGSKGKSGDIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKY |
TVVA.G.GSKGK.GDIQPV.VKV..KVL.P.YG.TKVVLDDKDYFLFRD.DI.GKY | |
Retrocopy | TVVALGLGSKGKGGDIQPVNVKV*HKVL-PDYGSTKVVLDDKDYFLFRDSDIPGKY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 58 .34 RPM |
SRP012922_cerebellum | 0 .00 RPM | 20 .90 RPM |
SRP012922_heart | 0 .00 RPM | 31 .56 RPM |
SRP012922_kidney | 0 .00 RPM | 108 .70 RPM |
SRP012922_liver | 0 .00 RPM | 78 .02 RPM |
SRP012922_lung | 0 .00 RPM | 35 .43 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 30 .46 RPM |
SRP012922_spleen | 0 .00 RPM | 62 .84 RPM |