RetrogeneDB ID: | retro_eeur_73 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
Coordinates: | GeneScaffold_4407:75632..75947(-) | ||
Located in intron of: | ENSEEUG00000004204 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TCEA1 | ||
Ensembl ID: | ENSEEUG00000009220 | ||
Aliases: | None | ||
Description: | transcription elongation factor A (SII), 1 [Source:HGNC Symbol;Acc:11612] |
Percent Identity: | 92.38 % |
Parental protein coverage: | 91.3 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | ISNLKDAKNPNLRKNVLCGNISPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCG |
....KDAKNPNLRKNVLCGNISPDLFARMTA.EMASDELKEMRK.LTKEAIREHQMAKTGGTQTDLFTCG | |
Retrocopy | VQQVKDAKNPNLRKNVLCGNISPDLFARMTAKEMASDELKEMRKSLTKEAIREHQMAKTGGTQTDLFTCG |
Parental | KCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWK |
KCKK.NCTYTQVQT.SADEPMTTFVVCNECGNRWK | |
Retrocopy | KCKKRNCTYTQVQTCSADEPMTTFVVCNECGNRWK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 11 .60 RPM | 14 .34 RPM |
SRP017611_kidney | 9 .94 RPM | 18 .57 RPM |
SRP017611_liver | 7 .72 RPM | 14 .95 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000001247 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000014407 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000013799 | 4 retrocopies | |
Erinaceus europaeus | ENSEEUG00000009220 | 1 retrocopy |
retro_eeur_73 ,
|
Homo sapiens | ENSG00000187735 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000023652 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000016022 | 1 retrocopy | |
Mus musculus | ENSMUSG00000033813 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000981 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007474 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000018589 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000020251 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000022323 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000013661 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000021179 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000001030 | 1 retrocopy |