RetrogeneDB ID: | retro_fcat_795 | ||
Retrocopy location | Organism: | Cat (Felis catus) | |
| Coordinates: | B2:124228531..124228885(-) | ||
| Located in intron of: | ENSFCAG00000001813 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RHOQ | ||
| Ensembl ID: | ENSFCAG00000015608 | ||
| Aliases: | None | ||
| Description: | ras homolog family member Q [Source:HGNC Symbol;Acc:17736] |
| Percent Identity: | 54.84 % |
| Parental protein coverage: | 89.13 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | EDYDRLRPLSYPMTDVFLICFSVVNPASFQNVKEEWVPELKEYAPNVPFLLIGTQIDLRDDPKTLARLND |
| E.Y..LRP.SY...DVFLICFSV.....F.NVKEEW..EL.E...NVP..L.GTQ.DL...P........ | |
| Retrocopy | EHYGHLRPVSYAVRDVFLICFSVT---LFRNVKEEWASELREHTLNVP-RLVGTQTDLQGEPQNFSKTE* |
| Parental | MKEKP-ICVEQGQKLAKEIGACCYVECSALTQKGLKTVFDEAIIAILTPKKHTV |
| ...K....VEQGQKLA...G....VE.S.LTQKGLKTVFDEA..AI..P.K.TV | |
| Retrocopy | YERKSCLYVEQGQKLARDRGH--HVESSTLTQKGLKTVFDEAVVAIIIPEKNTV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 6 .31 RPM |
| SRP017611_kidney | 0 .00 RPM | 13 .50 RPM |
| SRP017611_liver | 0 .00 RPM | 1 .11 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006082 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000000549 | 3 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000015226 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000019234 | 3 retrocopies | |
| Felis catus | ENSFCAG00000004853 | 4 retrocopies | |
| Felis catus | ENSFCAG00000011361 | 2 retrocopies | |
| Felis catus | ENSFCAG00000011671 | 1 retrocopy | |
| Felis catus | ENSFCAG00000015608 | 1 retrocopy |
retro_fcat_795 ,
|
| Felis catus | ENSFCAG00000025776 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000001567 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000013691 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000015415 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000008439 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011892 | 1 retrocopy |