RetrogeneDB ID: | retro_ggor_1198 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 15:36410970..36411251(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFB10 | ||
| Ensembl ID: | ENSGGOG00000009367 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 [Source:UniProtKB/Swiss-Prot;Acc:Q0MQF2] |
| Percent Identity: | 78.95 % |
| Parental protein coverage: | 54.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | VYEAEMQWRRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQ-FTQVAKAYQDRYQDLGAYYSAR |
| .YEAEMQWRRDYKVDQEI.NI.Q.RLK.CQQ.E..NY.QN..KEVE..FTQVAKAYQDRYQDLGA..SAR | |
| Retrocopy | IYEAEMQWRRDYKVDQEIVNIIQERLKTCQQWEEDNYRQNWAKEVEH<FTQVAKAYQDRYQDLGAHHSAR |
| Parental | KCLAKQRQRMLQERKAAKEAAAATS |
| KC.AKQ.QRML.ERKAAKEA.AA.S | |
| Retrocopy | KCQAKQKQRMLEERKAAKEATAAAS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 66 .66 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 49 .68 RPM |
| SRP007412_heart | 0 .00 RPM | 147 .56 RPM |
| SRP007412_kidney | 0 .00 RPM | 99 .77 RPM |
| SRP007412_liver | 0 .00 RPM | 41 .52 RPM |
| SRP007412_testis | 0 .00 RPM | 40 .92 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1573 |
| Pan troglodytes | retro_ptro_1060 |
| Pongo abelii | retro_pabe_1297 |
| Macaca mulatta | retro_mmul_2218 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000019476 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017154 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011738 | 1 retrocopy | |
| Homo sapiens | ENSG00000140990 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009367 | 2 retrocopies |
retro_ggor_1198 , retro_ggor_2555,
|
| Latimeria chalumnae | ENSLACG00000013152 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029268 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000040048 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008867 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006974 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007618 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014568 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030328 | 1 retrocopy |