RetrogeneDB ID: | retro_ggor_1402 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 18:19932736..19933168(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2C | ||
Ensembl ID: | ENSGGOG00000026061 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 72.67 % |
Parental protein coverage: | 81.77 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | RLQQELMTLMMSGDKGISAFPESDNLFKWVG-TIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPC |
R.QQEL.TL..SG.KGISA.P.SDNL.K.VG.TI..AAGT..EDLRYK.SLEFPSGYPYN.P.VKFLTPC | |
Retrocopy | RIQQELKTLVISGNKGISALPASDNLLKSVG<TIPEAAGT--EDLRYKVSLEFPSGYPYNMPLVKFLTPC |
Parental | YHPNVDTQ-GNICLDILKEKWSALYDVRTILLSIQSLLGATEPNIDSPLNTHAAELWKNPTAFKKYLQET |
Y..NVD.Q..N.CLDILK.KWSALYDVR..L.SI.SLL...E.NI.S.LNTHAAEL.KN.TAFKKYLQE. | |
Retrocopy | YYLNVDAQ>VNTCLDILKDKWSALYDVRNTLHSIHSLL--VELNINSLLNTHAAEL*KNSTAFKKYLQEI |
Parental | YSKQVTSQEP |
YSK.V...EP | |
Retrocopy | YSKHVSRKEP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .12 RPM |
SRP007412_heart | 0 .00 RPM | 0 .09 RPM |
SRP007412_kidney | 0 .04 RPM | 0 .33 RPM |
SRP007412_liver | 0 .05 RPM | 0 .55 RPM |
SRP007412_testis | 0 .10 RPM | 3 .94 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1922 |
Pongo abelii | retro_pabe_1589 |
Macaca mulatta | retro_mmul_1345 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Cavia porcellus | ENSCPOG00000014102 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000011774 | 4 retrocopies | |
Homo sapiens | ENSG00000175063 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000026061 | 3 retrocopies |
retro_ggor_1130, retro_ggor_1402 , retro_ggor_2035,
|
Macropus eugenii | ENSMEUG00000007177 | 14 retrocopies | |
Myotis lucifugus | ENSMLUG00000006715 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000021023 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000013661 | 6 retrocopies | |
Mus musculus | ENSMUSG00000001403 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000004989 | 3 retrocopies | |
Ochotona princeps | ENSOPRG00000014284 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000011071 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000013564 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000000369 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000015131 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000015987 | 1 retrocopy |