RetrogeneDB ID: | retro_mdom_575 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:357953775..357954180(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPL27A | ||
| Ensembl ID: | ENSMODG00000007480 | ||
| Aliases: | None | ||
| Description: | ribosomal protein L27a [Source:HGNC Symbol;Acc:10329] |
| Percent Identity: | 73.33 % |
| Parental protein coverage: | 91.22 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 0 |
| Parental | GHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMRHYHLKKNQSYCPTVNLDKLWTLV |
| GHVSH..G.I.KH.KH.GG.GNAG.LHHH..NF.K.H.GYFGKVGM.HYHLKKNQ.YC.TV.LDKLWTLV | |
| Retrocopy | GHVSHSSGCIDKHHKHLGGQGNAGRLHHH*VNFNKCHRGYFGKVGMKHYHLKKNQIYCQTVYLDKLWTLV |
| Parental | SEQTRINAAKSKEGLAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLV |
| SEQT..NA.KSK.GL..IIDV...GYY.VLG..KLPK..V.VKAKFFSRRAEE.IK.V.G.CVLV | |
| Retrocopy | SEQTKNNAVKSKDGLVSIIDVLC*GYYRVLGRRKLPK*SVMVKAKFFSRRAEETIKVVQGVCVLV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004205 | 15 retrocopies | |
| Bos taurus | ENSBTAG00000005349 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000006936 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000011775 | 1 retrocopy | |
| Felis catus | ENSFCAG00000008411 | 13 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001660 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000000425 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000016616 | 7 retrocopies | |
| Macaca mulatta | ENSMMUG00000021828 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000007480 | 1 retrocopy |
retro_mdom_575 ,
|
| Mustela putorius furo | ENSMPUG00000012532 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000046364 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000017535 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000005442 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000003333 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014214 | 10 retrocopies | |
| Sus scrofa | ENSSSCG00000014569 | 9 retrocopies | |
| Tarsius syrichta | ENSTSYG00000013207 | 16 retrocopies |