RetrogeneDB ID: | retro_mluc_2266 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL430164:650591..650908(-) | ||
| Located in intron of: | ENSMLUG00000016672 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS5 | ||
| Ensembl ID: | ENSMLUG00000012641 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.61 % |
| Parental protein coverage: | 52.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 4 |
| Parental | MSEWETAAPAVAET-PDIKLFGKWSTDDVQIRDINCA-DYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPI |
| M..WE.AAPA.AET.P..KLF.K.S..D.QI..I.C..D..AVK.K.AKYLPHSAG..AAK....AQCP. | |
| Retrocopy | MTQWEAAAPAGAET<PEVKLFRK*SNGDGQISGILCR<DHLAVK-KCAKYLPHSAGHHAAKHSCQAQCPL |
| Parental | -VERLTNSM-MMHGRNNGKKLMTVRIVKHAFEIIHLLTGENP |
| .VE.LTNS...MHGR.NG..L.T..IV.HAF...HLLTGENP | |
| Retrocopy | <VEPLTNSL<VMHGRSNGMELVTMPIVGHAFQVVHLLTGENP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002366 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000304 | 6 retrocopies | |
| Echinops telfairi | ENSETEG00000013543 | 1 retrocopy | |
| Homo sapiens | ENSG00000083845 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004258 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000015400 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012641 | 1 retrocopy |
retro_mluc_2266 ,
|
| Macaca mulatta | ENSMMUG00000008729 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008308 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000011921 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013088 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000011034 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010500 | 7 retrocopies | |
| Pan troglodytes | ENSPTRG00000011591 | 6 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000005935 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016955 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000000076 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001991 | 1 retrocopy |