RetrogeneDB ID: | retro_tbel_1169 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_399:396030..396471(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS5 | ||
| Ensembl ID: | ENSTBEG00000016955 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S5 [Source:HGNC Symbol;Acc:10426] |
| Percent Identity: | 63.82 % |
| Parental protein coverage: | 83.24 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | MTEWETATPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYA-KYLPHSAGR-YAAKRFRKAQC-P |
| .TEWETATP.VAE.P.I.LFGK.STDDVQIND.SLQDY.AV..K.A.KYLP.SAG...A..RFRK.QC.P | |
| Retrocopy | VTEWETATPTVAEDPAIRLFGKRSTDDVQINDVSLQDYMAVMDK*A<KYLPPSAGQ<VATTRFRKQQC<P |
| Parental | IVERLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRRQ |
| IV.R.TN......R..........IVKHAFE.IHLL..ENPLQV.VNAI..SGPRE.ST.I.RAGT.... | |
| Retrocopy | IV*RSTNCTKVRRRKRARS-SRLHIVKHAFETIHLLMAENPLQVPVNAIFSSGPRENSTCITRAGTEKHS |
| Parental | AVDVSPLRRVNQ |
| ...VSPL.RVNQ | |
| Retrocopy | LWTVSPLCRVNQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000002366 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000304 | 6 retrocopies | |
| Echinops telfairi | ENSETEG00000013543 | 1 retrocopy | |
| Homo sapiens | ENSG00000083845 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000004258 | 4 retrocopies | |
| Macropus eugenii | ENSMEUG00000015400 | 3 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012641 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000008729 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000008308 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000011921 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000013088 | 2 retrocopies | |
| Procavia capensis | ENSPCAG00000011034 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000010500 | 7 retrocopies | |
| Pan troglodytes | ENSPTRG00000011591 | 6 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000005935 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000016955 | 2 retrocopies |
retro_tbel_1127, retro_tbel_1169 ,
|
| Tarsius syrichta | ENSTSYG00000000076 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001991 | 1 retrocopy |