RetrogeneDB ID: | retro_mluc_2380 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL430277:94172..94409(+) | ||
Located in intron of: | ENSMLUG00000005794 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMLUG00000003449 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 89.87 % |
Parental protein coverage: | 88.76 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | LREKLRRDLQAEHVEVEDTTPNRCASSFRVLVVSAKFEGKPLLQRHRLVNACLAEELPHIHAFEQKTLTP |
LRE.LRRDLQAEHVEVE.TTPN...SSFRVLVVSAKFEGKPLLQRHRL.N.CLAEELPHIHAFEQKTLTP | |
Retrocopy | LRENLRRDLQAEHVEVEATTPNH*VSSFRVLVVSAKFEGKPLLQRHRLMNTCLAEELPHIHAFEQKTLTP |
Parental | EQWARERQK |
EQWAR.RQK | |
Retrocopy | EQWARKRQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
Homo sapiens | ENSG00000169627 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy |
retro_mluc_2380 ,
|
Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |