RetrogeneDB ID: | retro_ptro_1781 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 3:48211476..48211808(+) | ||
Located in intron of: | ENSPTRG00000014873 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPTRG00000007990 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.86 % |
Parental protein coverage: | 73.03 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | QQGSVAGVRAGVVSLLGCRFSWTVAMELSAEYLREKLQRNLEAEHVEVEDTTLNRCACSFRVLVVSAKFE |
.Q...AGV.AGV.SLLG...SWT.A.ELS...L.EKLQ...EA.H.EVED.TLNR.ACSFRVLVV.AKFE | |
Retrocopy | KQRGQAGV*AGVLSLLGYGPSWTAATELSTK*LQEKLQWDPEAKHMEVEDVTLNRRACSFRVLVVLAKFE |
Parental | GKPLLQRHRLVNACLAE-ELPHIHAFEQKTLTPDQWARERQK |
GK.LLQ.H..VN..LA...L.HIHAFEQKTL.P.QWA.ERQK | |
Retrocopy | GKLLLQTHWRVNMWLAG<RLSHIHAFEQKTLIPEQWACERQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .18 RPM | 14 .85 RPM |
SRP007412_cerebellum | 0 .29 RPM | 6 .38 RPM |
SRP007412_heart | 0 .00 RPM | 5 .33 RPM |
SRP007412_kidney | 0 .18 RPM | 11 .82 RPM |
SRP007412_liver | 0 .03 RPM | 10 .51 RPM |
SRP007412_testis | 0 .21 RPM | 12 .65 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
Homo sapiens | ENSG00000169627 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies |
retro_ptro_1284, retro_ptro_1781 ,
|
Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |