RetrogeneDB ID: | retro_pabe_2326 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3:99092322..99092672(-) | ||
Located in intron of: | ENSPPYG00000013917 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000007237 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 63.56 % |
Parental protein coverage: | 77.48 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | AEVAPVRQQGSAAAVRGVVSRLGCRPSWTTAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLV |
A.V....Q.G.A....GV.S.LG..PSWT.A.ELSAE.L..KLQ.D.EA.H.EVED.TLN.CACSF.VLV | |
Retrocopy | APVGVQKQRGQAGV*AGVLSLLGYGPSWTAATELSAE*LQKKLQWDPEAKHIEVEDVTLNHCACSF*VLV |
Parental | VSAKFEGKPLLQRHRLVNACLAE-ELPHIHAFEQKTLTPEQWARQRQK |
V.AKF.GK.LLQ.H..VN.CLA...L.HIH.FEQKTL.PEQWA...QK | |
Retrocopy | VLAKFKGKLLLQTHWWVNMCLAG<RLSHIHTFEQKTLIPEQWACEWQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .47 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .53 RPM |
SRP007412_heart | 0 .00 RPM | 3 .49 RPM |
SRP007412_kidney | 0 .00 RPM | 8 .49 RPM |
SRP007412_liver | 0 .00 RPM | 6 .46 RPM |
Species | RetrogeneDB ID |
---|---|
Callithrix jacchus | retro_cjac_1327 |
Macaca mulatta | retro_mmul_1522 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
Homo sapiens | ENSG00000169627 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007237 | 2 retrocopies |
retro_pabe_1608, retro_pabe_2326 ,
|
Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |