RetrogeneDB ID: | retro_sara_106 | ||
Retrocopylocation | Organism: | Shrew (Sorex araneus) | |
Coordinates: | GeneScaffold_3170:119745..119969(-) | ||
Located in intron of: | ENSSARG00000000802 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSARG00000003579 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 55.56 % |
Parental protein coverage: | 53.1 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 4 |
Parental | EKLQRDL-EADHVEVEDTTRDRCAASFRVLVVSSKFEGKPLL-QRHRLVNNCLSEELQHIHAFEQK-TLT |
EKL.RD..EADHVEV...TR.R.A.S.R.L...S...GKPLL..R.RLV..CLS......HA.EQK.TL. | |
Retrocopy | EKLRRDP<EADHVEVTAATRNRRAPSSRML-AGSRCGGKPLL<PRPRLVTECLSAGPLQTHASEQK<TLS |
Parental | -PEQWAHEKQK |
.P.QWA.E..K | |
Retrocopy | <PQQWAREQRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
Homo sapiens | ENSG00000169627 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
Sorex araneus | ENSSARG00000003579 | 2 retrocopies |
retro_sara_106 , retro_sara_278,
|
Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |