RetrogeneDB ID: | retro_mmul_1522 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 2:89016428..89016753(-) | ||
Located in intron of: | ENSMMUG00000013385 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BOLA2 | ||
Ensembl ID: | ENSMMUG00000007331 | ||
Aliases: | None | ||
Description: | BolA-like protein 2 [Source:RefSeq peptide;Acc:NP_001181399] |
Percent Identity: | 72.07 % |
Parental protein coverage: | 72.37 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | QGSVAGVGAGVVSPLGCRPSWTTAMELSAEYLREKLQRDLEAEHVEVEDTTLNRCACSFRVLVVSAKFEG |
Q...A.V.AGV.S.LGC.PSWT.A.ELSAE.LREKLQ.DLEAEHV.VED.TLNRCACSF.VLVVSAKF.G | |
Retrocopy | QRGQARV*AGVLSLLGCGPSWTAATELSAE*LREKLQWDLEAEHVKVEDVTLNRCACSF*VLVVSAKFKG |
Parental | KPLLQRHRLVNTCLA-EELPHIHAFEQKTLTPEQWARERQK |
K.LLQ.H...N.CLA.E.L.H..AFEQKTL.PEQ.A.E.QK | |
Retrocopy | KRLLQIHWRINVCLA>EALTH--AFEQKTLIPEQRACEQQK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 2 .13 RPM |
SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 7 .77 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .81 RPM |
SRP007412_heart | 0 .00 RPM | 5 .18 RPM |
SRP007412_kidney | 0 .12 RPM | 3 .52 RPM |
SRP007412_liver | 0 .04 RPM | 4 .39 RPM |
SRP007412_testis | 0 .00 RPM | 23 .78 RPM |
Species | RetrogeneDB ID |
---|---|
Callithrix jacchus | retro_cjac_1327 |
Pongo abelii | retro_pabe_2326 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
Homo sapiens | ENSG00000169627 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies |
retro_mmul_1344, retro_mmul_1522 , retro_mmul_1752,
|
Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |