RetrogeneDB ID: | retro_mmul_1752 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 4:21583178..21583517(+) | ||
Located in intron of: | ENSMMUG00000029951 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | BOLA2 | ||
Ensembl ID: | ENSMMUG00000007331 | ||
Aliases: | None | ||
Description: | BolA-like protein 2 [Source:RefSeq peptide;Acc:NP_001181399] |
Percent Identity: | 76.11 % |
Parental protein coverage: | 73.68 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | RLQGSVAGVGAGVVSPLGCRPSWTTAMELSAEYLREKLQRDLEAEHVEVEDTTL-NRCACSFRVLVVSAK |
R.Q.S.AGV..GV..PLGC..SWT.AMELSAEY..EKLQRDL.AEHV.VEDTT...RCACSFRVL.VSAK | |
Retrocopy | REQSSEAGVRTGVLCPLGCCSSWTIAMELSAEYFMEKLQRDLTAEHVAVEDTTTRSRCACSFRVLAVSAK |
Parental | FEGKPLLQRHRLVNTCLAEELPHIHAFEQKTLTPEQWARERQK |
FE.K.LLQRHRLVN.CLAE.L.HI..FEQKTL.PEQWARER.K | |
Retrocopy | FERKSLLQRHRLVNACLAEGLLHINTFEQKTLIPEQWARER*K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 2 .13 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .77 RPM |
SRP007412_cerebellum | 0 .00 RPM | 1 .81 RPM |
SRP007412_heart | 0 .00 RPM | 5 .18 RPM |
SRP007412_kidney | 0 .00 RPM | 3 .52 RPM |
SRP007412_liver | 0 .00 RPM | 4 .39 RPM |
SRP007412_testis | 5 .80 RPM | 23 .78 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
Homo sapiens | ENSG00000169627 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies |
retro_mmul_1344, retro_mmul_1522, retro_mmul_1752 ,
|
Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |