RetrogeneDB ID: | retro_mmul_1473 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 2:151857646..151858010(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.354 | ||
Ensembl ID: | ENSMMUG00000004447 | ||
Aliases: | None | ||
Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001181243] |
Percent Identity: | 59.35 % |
Parental protein coverage: | 98.39 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | ASVTFYRLLSRCGKAALSRPLGARCFGVRVSPTGEKITHTGQVYDDKDYRRIRFVDRQKEVNENFAIDLI |
A....Y.LL.......LS.P.GARCFGV...PTG.K..H..QV.D.KD.R.IRFV..Q.EVN.NFA.DLI | |
Retrocopy | AAAMIYQLLVWSSILVLSLPSGARCFGVWALPTGDKVMHASQVDDNKDSRKIRFVGCQEEVNVNFATDLI |
Parental | AEQPVSEVQTRVIACD-GGGGALGHPKVYINLDKETKTGTCGYCGLQFRQHPH |
.EQP.SEV...V..C..G.G.ALG.PKVY.N.DKETKTG.CGYCGL.F..H.H | |
Retrocopy | TEQPMSEVECWVVLCN>G*G-ALGYPKVYVNIDKETKTGICGYCGL*FKKHHH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 11 .77 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 26 .42 RPM |
SRP007412_cerebellum | 0 .00 RPM | 9 .43 RPM |
SRP007412_heart | 0 .00 RPM | 76 .61 RPM |
SRP007412_kidney | 0 .00 RPM | 31 .10 RPM |
SRP007412_liver | 0 .00 RPM | 29 .45 RPM |
SRP007412_testis | 0 .00 RPM | 80 .17 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2838 |
Pan troglodytes | retro_ptro_1924 |
Pongo abelii | retro_pabe_2350 |
Callithrix jacchus | retro_cjac_1552 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
Homo sapiens | ENSG00000145494 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy |
retro_mmul_1473 ,
|
Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021606 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000015323 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |