RetrogeneDB ID: | retro_mmus_3044 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 7:81161395..81161743(-) | ||
Located in intron of: | ENSMUSG00000025726 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000083820 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Ndufs6 | ||
Ensembl ID: | ENSMUSG00000021606 | ||
Aliases: | Ndufs6, BC059730, IP13 | ||
Description: | NADH dehydrogenase (ubiquinone) Fe-S protein 6 [Source:MGI Symbol;Acc:MGI:107932] |
Percent Identity: | 93.97 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAAVLTFRRLLTLPRAARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVN |
MA.VLTFR.LLTLPRAARGF.V.V.PSGEKITHTGQVYDEKDYRR.RFVDRQKEVNENFAIDLIAQQPVN | |
Retrocopy | MAVVLTFRWLLTLPRAARGFRVRVLPSGEKITHTGQVYDEKDYRRIRFVDRQKEVNENFAIDLIAQQPVN |
Parental | EVEHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH |
EV.HRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH | |
Retrocopy | EVDHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 24 .20 RPM |
SRP007412_cerebellum | 0 .04 RPM | 30 .18 RPM |
SRP007412_heart | 0 .65 RPM | 152 .79 RPM |
SRP007412_kidney | 0 .46 RPM | 91 .97 RPM |
SRP007412_liver | 0 .11 RPM | 36 .46 RPM |
SRP007412_testis | 0 .32 RPM | 26 .89 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_137588 | 738 libraries | 292 libraries | 33 libraries | 8 libraries | 1 library |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
Homo sapiens | ENSG00000145494 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021606 | 1 retrocopy |
retro_mmus_3044 ,
|
Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000015323 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |