RetrogeneDB ID: | retro_shar_176 | ||
Retrocopy location | Organism: | Tasmanian devil (Sarcophilus harrisii) | |
| Coordinates: | GL834539.1:2524758..2525037(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFS6 | ||
| Ensembl ID: | ENSSHAG00000017779 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7713] |
| Percent Identity: | 74.19 % |
| Parental protein coverage: | 60.78 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | SPTGEKITHTGQVYDDEDYRRIRFVGRQKEVNENFAIDLIAEQPVSKVESRVISCDGGGGALGHPKVYIN |
| .P...KITH.GQVYDDEDYR.I.F.G.QKEVNENFA.D.IAEQPV.KVES.VIS.D..GG.LGHPKVYIN | |
| Retrocopy | TPSRKKITHVGQVYDDEDYRIICFLGHQKEVNENFATDSIAEQPVNKVES*VISYDSEGGSLGHPKVYIN |
| Parental | LDKETKTGTCGYCGLQFKQHHHH |
| LDKETK.G..GYC.LQ.KQ..HH | |
| Retrocopy | LDKETKNGMSGYCELQLKQQYHH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
| Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
| Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
| Homo sapiens | ENSG00000145494 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000021606 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000015323 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy |
retro_shar_176 ,
|
| Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |