RetrogeneDB ID: | retro_rnor_1619 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 2:71800691..71801038(-) | ||
Located in intron of: | ENSRNOG00000012080 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSRNOG00000023387 | ||
Aliases: | None | ||
Description: | Protein LOC679739; RCG41951, isoform CRA_a [Source:UniProtKB/TrEMBL;Acc:D3ZCZ9] |
Percent Identity: | 52.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 4 |
Parental | MAAALTFRRLLALP-RAARGFGVRVS-RSGEKITHTGQVYDEKDYRRIRFVDRQKEVNENFAIDLIAQQP |
.A...T...L.ALP.RA...F.V.VS.R.G.....T.QVYD.KD.R.I..V..QKE.NE..A..LI..QP | |
Retrocopy | VATVVTSSWLMALP>RAEQDFRVQVS>RTGRG-SYTSQVYDDKDNRKIWIVGCQKELNETIATGLIVEQP |
Parental | VNEVDHRIIACDGGGGALGHPKVY-INLDKETKTGTCGY-CGLQFKQQHH |
V..V.HRI..CD.G.GALGHPK.....LDKET..G..GY..G.Q.KQ.HH | |
Retrocopy | VSKVAHRITTCDRGCGALGHPKTV>MRLDKETEAGIFGY<LGPQTKQNHH |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000010930 | 2 retrocopies | |
Bos taurus | ENSBTAG00000009914 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000019382 | 1 retrocopy | |
Equus caballus | ENSECAG00000021690 | 3 retrocopies | |
Homo sapiens | ENSG00000145494 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000004625 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000005708 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000016888 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004447 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000001425 | 1 retrocopy | |
Mus musculus | ENSMUSG00000021606 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011199 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000004581 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000015323 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016706 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000023387 | 1 retrocopy |
retro_rnor_1619 ,
|
Rattus norvegicus | ENSRNOG00000049394 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017779 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003715 | 1 retrocopy |