RetrogeneDB ID: | retro_mmul_1577 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 20:23087743..23087941(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ACBD7 | ||
Ensembl ID: | ENSMMUG00000010587 | ||
Aliases: | None | ||
Description: | acyl-CoA-binding domain-containing protein 7 [Source:RefSeq peptide;Acc:NP_001245104] |
Percent Identity: | 77.27 % |
Parental protein coverage: | 75. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | DDGELKELYGLYKQAIIGDINIECPGMLDLKGKAKWEAWNLKKGLSTEDAMSAYISKAKELIEKYG |
D..EL..L.GL.KQAIIGDINIE.PGMLDLK.KAKWEAWNL.KGLS.EDAM...ISKAKEL.EK.G | |
Retrocopy | DNKELRKLCGLHKQAIIGDINIEYPGMLDLKSKAKWEAWNLQKGLSKEDAMNVSISKAKELTEKQG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 7 .73 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .51 RPM |
SRP007412_cerebellum | 0 .06 RPM | 4 .39 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .23 RPM |
SRP007412_liver | 0 .00 RPM | 0 .16 RPM |
SRP007412_testis | 0 .00 RPM | 0 .08 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1669 |
Pan troglodytes | retro_ptro_1132 |
Gorilla gorilla | retro_ggor_1257 |
Pongo abelii | retro_pabe_1376 |
Callithrix jacchus | retro_cjac_1017 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy | |
Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
Homo sapiens | ENSG00000176244 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies |
retro_mmul_1577 , retro_mmul_2141,
|
Macaca mulatta | ENSMMUG00000011126 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002111 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |