RetrogeneDB ID: | retro_ggor_1257 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 16:25303410..25303575(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ACBD7 | ||
Ensembl ID: | ENSGGOG00000015777 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.36 % |
Parental protein coverage: | 62.5 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | GLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDAMSAYISKAKELIEK |
GLYKQAI.GDINI...GMLDLKGKAKW.AW.L.K.LS.EDA.S..ISKAKE.IEK | |
Retrocopy | GLYKQAIIGDINIEYLGMLDLKGKAKWAAWTLQKRLSKEDATSVSISKAKEPIEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .19 RPM |
SRP007412_cerebellum | 0 .08 RPM | 5 .16 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .41 RPM |
SRP007412_liver | 0 .00 RPM | 0 .29 RPM |
SRP007412_testis | 0 .00 RPM | 1 .04 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1669 |
Pan troglodytes | retro_ptro_1132 |
Pongo abelii | retro_pabe_1376 |
Macaca mulatta | retro_mmul_1577 |
Callithrix jacchus | retro_cjac_1017 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy | |
Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
Homo sapiens | ENSG00000176244 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000010372 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies |
retro_ggor_1152, retro_ggor_1257 , retro_ggor_625,
|
Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002111 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |