RetrogeneDB ID: | retro_pabe_1252 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 15:53709683..53709947(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ACBD7 | ||
Ensembl ID: | ENSPPYG00000002111 | ||
Aliases: | None | ||
Description: | acyl-CoA binding domain containing 7 [Source:HGNC Symbol;Acc:17715] |
Percent Identity: | 75. % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQVIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED |
M.LQADFD...EDVRKLK.RP.D.ELKELYGLYKQ...G.INI.C..ML.LKGKAKWEA.NL.K.LS.ED | |
Retrocopy | MSLQADFDMVTEDVRKLKTRPVDEELKELYGLYKQAVIGNINIECSEMLELKGKAKWEAQNLQKRLSEED |
Parental | AMSAYISKAKELIEKYGI |
.MSA.ISKA.ELIEKYGI | |
Retrocopy | MMSAFISKAEELIEKYGI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .30 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .97 RPM |
SRP007412_heart | 0 .00 RPM | 0 .03 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .10 RPM |
SRP007412_liver | 0 .00 RPM | 0 .06 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1501 |
Pan troglodytes | retro_ptro_1018 |
Gorilla gorilla | retro_ggor_1152 |
Macaca mulatta | retro_mmul_2141 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy | |
Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
Homo sapiens | ENSG00000176244 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002111 | 2 retrocopies |
retro_pabe_1252 , retro_pabe_1376,
|
Pongo abelii | ENSPPYG00000012788 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |