RetrogeneDB ID: | retro_nleu_1147 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397283.1:4079090..4079282(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ACBD7 | ||
Ensembl ID: | ENSNLEG00000012353 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 75. % |
Parental protein coverage: | 72.73 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | DDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDAMSAYISKAKELIEK |
D..E...L.GLYKQAI.GDINI..P.MLDLKGKAKWEAW.L.KGLS.EDA.S..ISKAKELIEK | |
Retrocopy | DNKEPNKLDGLYKQAIIGDINIEYPRMLDLKGKAKWEAWTLQKGLSKEDATSVSISKAKELIEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000009249 | 1 retrocopy | |
Felis catus | ENSFCAG00000027337 | 1 retrocopy | |
Homo sapiens | ENSG00000176244 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000015777 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000010587 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010290 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000012353 | 2 retrocopies |
retro_nleu_1147 , retro_nleu_1720,
|
Pongo abelii | ENSPPYG00000002111 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000041316 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000007153 | 1 retrocopy |