RetrogeneDB ID: | retro_mmul_1996 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 6:29654003..29654183(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBL5 | ||
Ensembl ID: | ENSMMUG00000007877 | ||
Aliases: | None | ||
Description: | ubiquitin-like protein 5 [Source:RefSeq peptide;Acc:NP_001247979] |
Percent Identity: | 71.43 % |
Parental protein coverage: | 83.56 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MIEVVC-NDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTR-WNKIVLKKWYTIFKDHVSLGDYE |
M..VVC..D.LGKKVR.KCNTDDTIGD.KKL..AQ.GT..W.K.VL.K.Y.IFK.HVSLGDYE | |
Retrocopy | MTKVVC<HDFLGKKVRIKCNTDDTIGDSKKLTVAQAGTL>WDKSVLNK-YMIFKNHVSLGDYE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 59 .83 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 64 .50 RPM |
SRP007412_cerebellum | 0 .00 RPM | 43 .33 RPM |
SRP007412_heart | 0 .00 RPM | 88 .86 RPM |
SRP007412_kidney | 0 .00 RPM | 78 .64 RPM |
SRP007412_liver | 0 .00 RPM | 45 .64 RPM |
SRP007412_testis | 0 .00 RPM | 56 .50 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3154 |
Pan troglodytes | retro_ptro_2280 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006097 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
Homo sapiens | ENSG00000198258 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000007877 | 2 retrocopies |
retro_mmul_1437, retro_mmul_1996 ,
|
Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009536 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010451 | 3 retrocopies | |
Pteropus vampyrus | ENSPVAG00000008628 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000023331 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000008535 | 1 retrocopy |