RetrogeneDB ID: | retro_ptro_1895 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 3:64133256..64133412(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBL5 | ||
Ensembl ID: | ENSPTRG00000010451 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.15 % |
Parental protein coverage: | 71.23 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | DTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ |
.T..D.KKLIAAQ..T...KI.LKKWY.IFKDH..LGD.EIHDGMNLELY.Q | |
Retrocopy | ETLRDRKKLIAAQAVTHCKKIILKKWYMIFKDHTILGDHEIHDGMNLELYFQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 65 .78 RPM |
SRP007412_cerebellum | 0 .00 RPM | 44 .02 RPM |
SRP007412_heart | 0 .00 RPM | 50 .10 RPM |
SRP007412_kidney | 0 .00 RPM | 92 .05 RPM |
SRP007412_liver | 0 .00 RPM | 61 .21 RPM |
SRP007412_testis | 0 .00 RPM | 118 .66 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2798 |
Pongo abelii | retro_pabe_2226 |
Macaca mulatta | retro_mmul_1437 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006097 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
Homo sapiens | ENSG00000198258 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000007877 | 2 retrocopies | |
Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009536 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010451 | 3 retrocopies |
retro_ptro_1170, retro_ptro_1895 , retro_ptro_2280,
|
Pteropus vampyrus | ENSPVAG00000008628 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000023331 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000008535 | 1 retrocopy |