RetrogeneDB ID: | retro_mmul_1437 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 2:73162994..73163150(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBL5 | ||
| Ensembl ID: | ENSMMUG00000007877 | ||
| Aliases: | None | ||
| Description: | ubiquitin-like protein 5 [Source:RefSeq peptide;Acc:NP_001247979] |
| Percent Identity: | 75.0 % |
| Parental protein coverage: | 71.23 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | DTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ |
| .T..DLKKLIAAQ..T...KI.LKKWY.IFKDH.SLGD.EIHDGMNLELY.Q | |
| Retrocopy | ETLRDLKKLIAAQGVTHCKKIILKKWYMIFKDHTSLGDHEIHDGMNLELYSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 59 .83 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 64 .50 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 43 .33 RPM |
| SRP007412_heart | 0 .00 RPM | 88 .86 RPM |
| SRP007412_kidney | 0 .00 RPM | 78 .64 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .64 RPM |
| SRP007412_testis | 0 .00 RPM | 56 .50 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2798 |
| Pan troglodytes | retro_ptro_1895 |
| Pongo abelii | retro_pabe_2226 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006097 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000006384 | 5 retrocopies | |
| Homo sapiens | ENSG00000198258 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000005999 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012892 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000015506 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000027369 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000007877 | 2 retrocopies |
retro_mmul_1437 , retro_mmul_1996,
|
| Mus musculus | ENSMUSG00000084786 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009536 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010451 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000008628 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000010974 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000023331 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008535 | 1 retrocopy |