RetrogeneDB ID: | retro_mmul_721 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 1099214747682:786..1077(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.4339 | ||
Ensembl ID: | ENSMMUG00000021075 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 57.58 % |
Parental protein coverage: | 53.89 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 2 |
Parental | VGKTCLLISYT-TNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICF |
.GK.CLL..YT.TN.F.GEY..TV..N.S.N.M.D.K.VNLGL.DTA...D..R.R............CF | |
Retrocopy | LGKICLLVNYT<TNVFCGEYMSTVSENSSFNIMIDRKLVNLGL*DTANL*DHHR*RXXXXXXXXXNRFCF |
Parental | -SLVSPASFENVRAKWYPEVRHHCPNTPI |
.S..SPA.FENV.AKWYPEV.HHCPNTPI | |
Retrocopy | >SFTSPALFENVFAKWYPEV*HHCPNTPI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 250 .10 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 187 .62 RPM |
SRP007412_cerebellum | 0 .00 RPM | 177 .26 RPM |
SRP007412_heart | 0 .00 RPM | 88 .62 RPM |
SRP007412_kidney | 0 .00 RPM | 125 .94 RPM |
SRP007412_liver | 0 .00 RPM | 73 .03 RPM |
SRP007412_testis | 0 .00 RPM | 39 .58 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000009233 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000015716 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000026733 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000018854 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000021075 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000022009 | 8 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000009956 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000018910 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000007272 | 4 retrocopies | |
Xenopus tropicalis | ENSXETG00000027593 | 1 retrocopy |