RetrogeneDB ID: | retro_mmul_991 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 13:59700826..59701065(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSMMUG00000005524 | ||
Aliases: | None | ||
Description: | U6 snRNA-associated Sm-like protein LSm6 [Source:RefSeq peptide;Acc:NP_001253894] |
Percent Identity: | 66.67 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIAL-EQTEEYVNGQLKNKYGDAFIRGNN |
MSL.KQ..S.FLK..I.RPV.VKLNSGV.Y.G.LACLD...NIAL.E..EEY..GQ.K.KYG.AFI.GNN | |
Retrocopy | MSLWKQASSAFLKHVIRRPVMVKLNSGVNY*GDLACLDDCSNIAL<EKAEEYISGQPKTKYGYAFI*GNN |
Parental | VLYISTQKRRM |
V.YIS.Q..RM | |
Retrocopy | VSYISAQETRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 7 .17 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 7 .62 RPM |
SRP007412_heart | 0 .00 RPM | 10 .78 RPM |
SRP007412_kidney | 0 .00 RPM | 7 .51 RPM |
SRP007412_liver | 0 .00 RPM | 7 .88 RPM |
SRP007412_testis | 0 .00 RPM | 10 .29 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2107 |
Pan troglodytes | retro_ptro_1545 |
Gorilla gorilla | retro_ggor_1638 |
Pongo abelii | retro_pabe_1994 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies |
retro_mmul_668, retro_mmul_991 ,
|
Macaca mulatta | ENSMMUG00000009302 | 4 retrocopies | |
Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |