RetrogeneDB ID: | retro_pabe_1994 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 2a:51412645..51412884(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSPPYG00000015105 | ||
Aliases: | None | ||
Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
Percent Identity: | 66.67 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIAL-EQTEEYVNGQLKNKYGDAFIRGNN |
M.L.KQT.S.FLK.II.RPVVVKLN..V.Y.G.LACLD...NIAL.E..EEY..GQ.K.KYG.AF..GNN | |
Retrocopy | MNLWKQTSSAFLKHIIRRPVVVKLNPRVNY*GDLACLDDCSNIAL<ETAEEYISGQPKIKYGYAFV*GNN |
Parental | VLYISTQKRRM |
V..ISTQ.RRM | |
Retrocopy | VSHISTQERRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .25 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .93 RPM |
SRP007412_heart | 0 .00 RPM | 4 .40 RPM |
SRP007412_kidney | 0 .00 RPM | 6 .03 RPM |
SRP007412_liver | 0 .00 RPM | 5 .75 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2107 |
Pan troglodytes | retro_ptro_1545 |
Gorilla gorilla | retro_ggor_1638 |
Macaca mulatta | retro_mmul_991 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004847 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000015105 | 1 retrocopy |
retro_pabe_1994 ,
|
Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |