RetrogeneDB ID: | retro_ogar_233 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873670.1:1770370..1770613(-) | ||
Located in intron of: | ENSOGAG00000000012 | ||
Retrocopyinformation | Ensembl ID: | ENSOGAG00000033153 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOGAG00000026665 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 100. % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV |
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV | |
Retrocopy | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV |
Parental | LYISTQKRRM |
LYISTQKRRM | |
Retrocopy | LYISTQKRRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Homo sapiens | ENSG00000164167 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy |
retro_ogar_233 ,
|
Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |