RetrogeneDB ID: | retro_dnov_664 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_7412:76295..76508(-) | ||
Located in intron of: | ENSDNOG00000010588 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSDNOG00000009322 | ||
Aliases: | None | ||
Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
Percent Identity: | 76.39 % |
Parental protein coverage: | 90. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | SDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTPKR |
SDFLKQI.G.P.VVKLNS.VDYRGVLACLDGYMNI.LE...EYVNGQL..KYGDA.I.GN.VL..ST.KR | |
Retrocopy | SDFLKQILGWPAVVKLNSRVDYRGVLACLDGYMNIGLEKL-EYVNGQLQSKYGDADI*GNTVLHLSTQKR |
Parental | GM |
.M | |
Retrocopy | RM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .19 RPM | 10 .31 RPM |
SRP012922_cerebellum | 0 .00 RPM | 9 .90 RPM |
SRP012922_heart | 0 .23 RPM | 6 .50 RPM |
SRP012922_kidney | 0 .00 RPM | 5 .20 RPM |
SRP012922_liver | 0 .00 RPM | 3 .10 RPM |
SRP012922_lung | 0 .15 RPM | 7 .33 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 6 .75 RPM |
SRP012922_spleen | 0 .00 RPM | 9 .96 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Homo sapiens | ENSG00000164167 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |