RetrogeneDB ID: | retro_ptro_1545 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 2A:60388701..60388940(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSPTRG00000016488 | ||
| Aliases: | None | ||
| Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
| Percent Identity: | 67.9 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIAL-EQTEEYVNGQLKNKYGDAFIRGNN |
| M.L.KQT.S.FLK.II.RPVVVKLN.GV.Y.G.LACLD...NIAL.E..EEY..GQ.K.KYG.AF..GNN | |
| Retrocopy | MNLWKQTSSAFLKHIIRRPVVVKLNPGVNY*GDLACLDDCSNIAL<EKAEEYISGQPKTKYGYAFL*GNN |
| Parental | VLYISTQKRRM |
| V..ISTQ.RRM | |
| Retrocopy | VSHISTQERRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .02 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 9 .93 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .96 RPM |
| SRP007412_kidney | 0 .00 RPM | 5 .47 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .12 RPM |
| SRP007412_testis | 0 .00 RPM | 14 .75 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2107 |
| Gorilla gorilla | retro_ggor_1638 |
| Pongo abelii | retro_pabe_1994 |
| Macaca mulatta | retro_mmul_991 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000031683 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy |
retro_ptro_1545 ,
|
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |