RetrogeneDB ID: | retro_mmus_820 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 11:78149198..78149438(-) | ||
Located in intron of: | ENSMUSG00000037750 | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000060727 | |
Aliases: | None | ||
Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Lsm6 | ||
Ensembl ID: | ENSMUSG00000031683 | ||
Aliases: | Lsm6, 1500031N17Rik, 2410088K19Rik, AI747288 | ||
Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1925901] |
Percent Identity: | 97.5 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV |
MSLRKQ.PSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV | |
Retrocopy | MSLRKQPPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNV |
Parental | LYISTQKRRM |
LYISTQKR.M | |
Retrocopy | LYISTQKRWM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .09 RPM | 26 .73 RPM |
SRP007412_cerebellum | 0 .35 RPM | 42 .99 RPM |
SRP007412_heart | 0 .16 RPM | 16 .25 RPM |
SRP007412_kidney | 0 .17 RPM | 19 .58 RPM |
SRP007412_liver | 0 .14 RPM | 22 .07 RPM |
SRP007412_testis | 0 .05 RPM | 10 .57 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002482 | 4 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Microcebus murinus | ENSMICG00000000571 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005524 | 2 retrocopies | |
Mus musculus | ENSMUSG00000020018 | 4 retrocopies | |
Mus musculus | ENSMUSG00000031683 | 2 retrocopies |
retro_mmus_820 , retro_mmus_956,
|
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000015105 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000016488 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |