RetrogeneDB ID: | retro_mmus_3223 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 8:81024035..81024278(-) | ||
| Located in intron of: | ENSMUSG00000037982 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrps36 | ||
| Ensembl ID: | ENSMUSG00000061474 | ||
| Aliases: | Mrps36, 1110018B13Rik, S36mt | ||
| Description: | mitochondrial ribosomal protein S36 [Source:MGI Symbol;Acc:MGI:1913378] |
| Percent Identity: | 53.01 % |
| Parental protein coverage: | 81.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MGSKMASATRVVQVVKPHAPLIKFPNRRDKPKLSASEALGSAALPSHSSAISQHSKGSTSPDLLMHQGPP |
| MG.K...A.R..Q.VK.H.........R..PK.S..EAL.SA.LPSH.S.ISQHSKGS.SPDLL....P. | |
| Retrocopy | MGTKKVLASRDTQIVKVHT--LQHDSLRNDPKPST*EALTSAGLPSHASGISQHSKGSWSPDLLRQWNPL |
| Parental | DTAEIIKSLPQKY |
| D..EI.K.LP..Y | |
| Retrocopy | DIEEITKILPSNY |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 3 .46 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 3 .08 RPM |
| SRP007412_heart | 0 .00 RPM | 14 .10 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .95 RPM |
| SRP007412_liver | 0 .05 RPM | 3 .74 RPM |
| SRP007412_testis | 0 .14 RPM | 6 .91 RPM |