RetrogeneDB ID: | retro_rnor_2014 | ||
Retrocopy location | Organism: | Rat (Rattus norvegicus) | |
| Coordinates: | 4:222214743..222214970(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrps36 | ||
| Ensembl ID: | ENSRNOG00000048862 | ||
| Aliases: | None | ||
| Description: | 28S ribosomal protein S36, mitochondrial [Source:RefSeq peptide;Acc:NP_001178534] |
| Percent Identity: | 67.5 % |
| Parental protein coverage: | 76.7 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MGSKMASATR-VVQVVKPHAPLIKFPNRRDKPKLSASDTLRSAALPSHSSVISQHSKGNLSPNLLMHQGP |
| MGSKMASA.R.VVQ.VKPH.PLI.FPNRRD....SAS..L.SA.LP.H.SVI.Q.SKG.L.P.LLM.Q.P | |
| Retrocopy | MGSKMASASR<VVQLVKPHDPLIRFPNRRDN---SASEALGSAVLPFHTSVIAQRSKGSLCPDLLMYQEP |
| Parental | PDTAELIKSL |
| .DTAE.IK.. | |
| Retrocopy | SDTAEIIKNI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 17 .40 RPM |
| SRP017611_kidney | 0 .00 RPM | 36 .29 RPM |
| SRP017611_liver | 0 .00 RPM | 8 .47 RPM |