RetrogeneDB ID: | retro_pabe_2219 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 3:63277976..63278150(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS36 | ||
| Ensembl ID: | ENSPPYG00000015524 | ||
| Aliases: | None | ||
| Description: | 28S ribosomal protein S36, mitochondrial [Source:RefSeq peptide;Acc:NP_001185669] |
| Percent Identity: | 96.55 % |
| Parental protein coverage: | 56.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHSSVISQHSKG |
| M.GSKMASASRVVQVVKPHTPLIRFPDRRD.PKPNVSEALRSAGLPSHSSVISQHSKG | |
| Retrocopy | MIGSKMASASRVVQVVKPHTPLIRFPDRRDTPKPNVSEALRSAGLPSHSSVISQHSKG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .52 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 6 .57 RPM |
| SRP007412_heart | 0 .06 RPM | 17 .01 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .73 RPM |
| SRP007412_liver | 0 .00 RPM | 6 .12 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2750 |
| Pan troglodytes | retro_ptro_1858 |