RetrogeneDB ID: | retro_mmus_648 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 10:61510203..61510604(-) | ||
Located in intron of: | ENSMUSG00000037151 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Ostc | ||
Ensembl ID: | ENSMUSG00000041084 | ||
Aliases: | Ostc, 2310008M10Rik, 5730557H03Rik | ||
Description: | oligosaccharyltransferase complex subunit [Source:MGI Symbol;Acc:MGI:1913607] |
Percent Identity: | 82.22 % |
Parental protein coverage: | 89.26 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | LKLKKPPWVH-MPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIM |
L.LKK..WVH..PSAMTVY..VVVSYFL.TGG.IY.VIVEPPSVGSM.D.HGHQRPVAFLAYRVNGQY.M | |
Retrocopy | LGLKKLSWVH>LPSAMTVYTMVVVSYFLMTGGMIYGVIVEPPSVGSMMDKHGHQRPVAFLAYRVNGQYVM |
Parental | EGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIG-FVCVLLSFFMARVFMRMKLPGYLMG |
EGLASSFLF.MGGLGFIILD.SN.PNI.KL.RFLLLF.G.F..VL.SFFMARVFMRMKL.GYLMG | |
Retrocopy | EGLASSFLFPMGGLGFIILD*SNTPNISKLDRFLLLFVG>FIWVLRSFFMARVFMRMKLLGYLMG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .07 RPM | 23 .50 RPM |
SRP007412_cerebellum | 0 .00 RPM | 17 .54 RPM |
SRP007412_heart | 0 .00 RPM | 19 .61 RPM |
SRP007412_kidney | 0 .04 RPM | 23 .12 RPM |
SRP007412_liver | 0 .00 RPM | 32 .82 RPM |
SRP007412_testis | 0 .05 RPM | 11 .39 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001753 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000011286 | 12 retrocopies | |
Callithrix jacchus | ENSCJAG00000016002 | 3 retrocopies | |
Cavia porcellus | ENSCPOG00000024467 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000003717 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000026873 | 6 retrocopies | |
Monodelphis domestica | ENSMODG00000020599 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000008869 | 1 retrocopy | |
Mus musculus | ENSMUSG00000041084 | 1 retrocopy |
retro_mmus_648 ,
|
Oryctolagus cuniculus | ENSOCUG00000011056 | 2 retrocopies | |
Pteropus vampyrus | ENSPVAG00000005915 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000023322 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009145 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000021644 | 6 retrocopies | |
Tarsius syrichta | ENSTSYG00000000724 | 2 retrocopies |