RetrogeneDB ID: | retro_mmus_908 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 12:116597244..116597560(+) | ||
| Located in intron of: | ENSMUSG00000056553 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Atpif1 | ||
| Ensembl ID: | ENSMUSG00000054428 | ||
| Aliases: | Atpif1, Atpi, If1 | ||
| Description: | ATPase inhibitory factor 1 [Source:MGI Symbol;Acc:MGI:1196457] |
| Percent Identity: | 77.57 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MAGSALAVRARFGVWGMKVLQTRGFVSDSSDSMDTGAGSIREAGGAFGKREKAEEDRYFREKTKEQLAAL |
| ..GSALAVRAR.GVWGM..LQTRGFVSD...SMDTGAG.IREAG.AFGKREKAEEDRYFREK..EQLAAL | |
| Retrocopy | LTGSALAVRARLGVWGMRALQTRGFVSDLMESMDTGAG*IREAGRAFGKREKAEEDRYFREKAREQLAAL |
| Parental | -RKHHEDEIDHHSKEIERLQKQIERHKKKIQQLKNNH |
| ..KHHE.E.DHHSKEIERLQKQIE....KI..LK..H | |
| Retrocopy | >KKHHENEVDHHSKEIERLQKQIE-CREKIKHLKCGH |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .21 RPM | 52 .59 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 39 .90 RPM |
| SRP007412_heart | 0 .00 RPM | 36 .58 RPM |
| SRP007412_kidney | 0 .06 RPM | 77 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .54 RPM |
| SRP007412_testis | 0 .00 RPM | 58 .23 RPM |
| ENCODE library ID | Target | ChIP-Seq Peak coordinates |
|---|---|---|
| ENCFF001YIJ | POLR2A | 12:116596916..116598851 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000032458 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000009581 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000015460 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000170 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000015536 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000054428 | 2 retrocopies |
retro_mmus_2516, retro_mmus_908 ,
|
| Otolemur garnettii | ENSOGAG00000010337 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000017615 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000013300 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000010860 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020766 | 1 retrocopy |