RetrogeneDB ID: | retro_nleu_604 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397268.1:2893182..2893418(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FKBP1C | ||
Ensembl ID: | ENSNLEG00000009356 | ||
Aliases: | None | ||
Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:G1RDV4] |
Percent Identity: | 81.25 % |
Parental protein coverage: | 73.15 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDR-NKPFKFMLGKQEVIRGWEEGVAQMSV |
MGVQVETISPGD..T..KRGQT.V.HYTGMLEDGKKF.SSRDR..KPFK.MLGKQEVI.GWEEGV..MS. | |
Retrocopy | MGVQVETISPGDAHTLLKRGQTWVMHYTGMLEDGKKFCSSRDR<KKPFKLMLGKQEVIPGWEEGVVHMSA |
Parental | GQRAKLTISP |
GQ.AKLTISP | |
Retrocopy | GQTAKLTISP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
Homo sapiens | ENSG00000088832 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000800 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000002835 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000009356 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000002629 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |