RetrogeneDB ID: | retro_ptro_818 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 13:46194318..46194639(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | FKBP1A | ||
Ensembl ID: | ENSPTRG00000013163 | ||
Aliases: | None | ||
Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:H2QJT5] |
Percent Identity: | 80.37 % |
Parental protein coverage: | 99.07 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQ |
GV.VETISPG...TFP..GQ.CV.HYTGMLE.GKK..S..DRNK.FKFMLGK.EVI.GWEEGVAQ.SVGQ | |
Retrocopy | GVRVETISPGEECTFPMHGQSCVLHYTGMLEGGKKIHSPLDRNKFFKFMLGKLEVI*GWEEGVAQKSVGQ |
Parental | RAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
R.KLT.SPDYAYG.TGHPGIIPPHATLVFD.ELLKLE | |
Retrocopy | RDKLTTSPDYAYGTTGHPGIIPPHATLVFDMELLKLE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 168 .25 RPM |
SRP007412_cerebellum | 0 .00 RPM | 41 .66 RPM |
SRP007412_heart | 0 .00 RPM | 47 .33 RPM |
SRP007412_kidney | 0 .00 RPM | 89 .83 RPM |
SRP007412_liver | 0 .03 RPM | 48 .02 RPM |
SRP007412_testis | 0 .00 RPM | 44 .89 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1198 |
Gorilla gorilla | retro_ggor_933 |
Pongo abelii | retro_pabe_998 |
Callithrix jacchus | retro_cjac_537 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
Homo sapiens | ENSG00000088832 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000009356 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000002629 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000010852 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000004529 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies |
retro_ptro_2983, retro_ptro_818 ,
|
Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |