RetrogeneDB ID: | retro_ptro_818 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 13:46194318..46194639(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | FKBP1A | ||
| Ensembl ID: | ENSPTRG00000013163 | ||
| Aliases: | None | ||
| Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:H2QJT5] |
| Percent Identity: | 80.37 % |
| Parental protein coverage: | 99.07 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQ |
| GV.VETISPG...TFP..GQ.CV.HYTGMLE.GKK..S..DRNK.FKFMLGK.EVI.GWEEGVAQ.SVGQ | |
| Retrocopy | GVRVETISPGEECTFPMHGQSCVLHYTGMLEGGKKIHSPLDRNKFFKFMLGKLEVI*GWEEGVAQKSVGQ |
| Parental | RAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
| R.KLT.SPDYAYG.TGHPGIIPPHATLVFD.ELLKLE | |
| Retrocopy | RDKLTTSPDYAYGTTGHPGIIPPHATLVFDMELLKLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 168 .25 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 41 .66 RPM |
| SRP007412_heart | 0 .00 RPM | 47 .33 RPM |
| SRP007412_kidney | 0 .00 RPM | 89 .83 RPM |
| SRP007412_liver | 0 .03 RPM | 48 .02 RPM |
| SRP007412_testis | 0 .00 RPM | 44 .89 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1198 |
| Gorilla gorilla | retro_ggor_933 |
| Pongo abelii | retro_pabe_998 |
| Callithrix jacchus | retro_cjac_537 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020908 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Homo sapiens | ENSG00000088832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009356 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000002629 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000010852 | 5 retrocopies | |
| Pan troglodytes | ENSPTRG00000004529 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000011708 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000013163 | 2 retrocopies |
retro_ptro_2983, retro_ptro_818 ,
|
| Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |