RetrogeneDB ID: | retro_pabe_2697 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 5:147651975..147652353(+) | ||
| Located in intron of: | ENSPPYG00000015906 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | APOOL | ||
| Ensembl ID: | ENSPPYG00000020516 | ||
| Aliases: | None | ||
| Description: | apolipoprotein O-like [Source:HGNC Symbol;Acc:24009] |
| Percent Identity: | 91.27 % |
| Parental protein coverage: | 53.16 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GKLTTMPAGLIYASVSVHAAKEEESKKQLVKPEQLPIYTVPPLQSKYVEEQPGHLQMGFASIRTATGCYI |
| GKLTT.PA.LI.ASVSVHAAKEEESKKQLVKPEQLP.YT.PPLQSKYVEEQPGHLQ.GFASI.TATG.Y. | |
| Retrocopy | GKLTTIPASLIRASVSVHAAKEEESKKQLVKPEQLPVYTAPPLQSKYVEEQPGHLQTGFASIYTATGHYT |
| Parental | GWCKGVYVFVKNGIMDTVQFGKDAYVYMKNPPRDFLPKMGVITVSGLAGLVSARKV |
| GWCKGVYVFVKN.IMDTVQFGKDAYVY.KNPPRDFLPKMGVITVSGLAGLVSARKV | |
| Retrocopy | GWCKGVYVFVKNVIMDTVQFGKDAYVYLKNPPRDFLPKMGVITVSGLAGLVSARKV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 2 .27 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 2 .07 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .20 RPM |
| SRP007412_kidney | 0 .07 RPM | 1 .99 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .68 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3253 |
| Pan troglodytes | retro_ptro_2200 |
| Gorilla gorilla | retro_ggor_2213 |
| Macaca mulatta | retro_mmul_2045 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000000829 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000017383 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008249 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000011045 | 1 retrocopy | |
| Equus caballus | ENSECAG00000009229 | 1 retrocopy | |
| Homo sapiens | ENSG00000155008 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016329 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000008844 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000015844 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000011384 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004335 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000001899 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000002634 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020191 | 7 retrocopies | |
| Pongo abelii | ENSPPYG00000020516 | 1 retrocopy |
retro_pabe_2697 ,
|
| Pan troglodytes | ENSPTRG00000022067 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012459 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000429 | 1 retrocopy |