RetrogeneDB ID: | retro_sscr_610 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 2:2216525..2216940(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | APOOL | ||
Ensembl ID: | ENSSSCG00000012459 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 62.41 % |
Parental protein coverage: | 51.87 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MAAFRMRKLTTMPVGLICASVSVHVAKEEESRKQLVKPEQLPIYTAPPLQSKYVEEQPGRLQ-VGFASI- |
..AFRM...TTM..GLI.ASV..H.AKEE...KQL.KPEQLPI.T.PPL.S.Y.EEQPG.L...GF.S.. | |
Retrocopy | VTAFRMGEWTTMAAGLIVASVKGHAAKEEDAKKQLMKPEQLPITTKPPLRSRYAEEQPGCLP<KGFEST< |
Parental | RTTTGRYLGWCKSAYVFMKNGIKDAVQFGKDAYVYLKNPPRDFLPKIGVITVSGLAGFVSARKGSRFKKI |
.T.TGRY.GWCK...VF.KN....AVQFGK...VY.KNPP...LPK.G.I..S.L.GFVSAR.GSRF.KI | |
Retrocopy | STATGRYFGWCKGVSVFVKNRSTGAVQFGKGGCVYAKNPPGNVLPKMGGISASALVGFVSARRGSRFRKI |
Parental | A |
A | |
Retrocopy | A |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 3 .72 RPM |
SRP014902_testis | 0 .00 RPM | 4 .81 RPM |
SRP018288_heart | 0 .00 RPM | 28 .11 RPM |
SRP018288_kidney | 0 .00 RPM | 21 .97 RPM |
SRP018288_liver | 0 .00 RPM | 12 .15 RPM |
SRP018288_lung | 0 .00 RPM | 4 .58 RPM |
SRP018856_adipose | 0 .00 RPM | 6 .55 RPM |
SRP035408_brain | 0 .00 RPM | 4 .80 RPM |
SRP035408_liver | 0 .00 RPM | 22 .66 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000000829 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000017383 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000008249 | 2 retrocopies | |
Dipodomys ordii | ENSDORG00000011045 | 1 retrocopy | |
Equus caballus | ENSECAG00000009229 | 1 retrocopy | |
Homo sapiens | ENSG00000155008 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000016329 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000008844 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000015844 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000011384 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000004335 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000001899 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000002634 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000020516 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000022067 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012174 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012459 | 1 retrocopy |
retro_sscr_610 ,
|
Tupaia belangeri | ENSTBEG00000010147 | 5 retrocopies | |
Tursiops truncatus | ENSTTRG00000000429 | 1 retrocopy |