RetrogeneDB ID: | retro_pabe_3412 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 9:56963197..56963559(+) | ||
Located in intron of: | ENSPPYG00000019234 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AK4 | ||
Ensembl ID: | ENSPPYG00000001269 | ||
Aliases: | AK3, AK 4, AK3L1, AK4 | ||
Description: | Adenylate kinase isoenzyme 4, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q5R421] |
Percent Identity: | 77.87 % |
Parental protein coverage: | 54.26 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | DKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAAR |
DK..EVDLVI.L.IPFETLKD.LSRRWIHPP..RVYNL.FNPP.VHGIDD..GEPL.QQEDD..EAVAAR | |
Retrocopy | DKMYEVDLVICLKIPFETLKDCLSRRWIHPPCSRVYNLGFNPPGVHGIDDISGEPLIQQEDDRLEAVAAR |
Parental | LRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYT-LFSNKITPIQSKE |
.RQYK.VAKPVI.L.KS.GVLH.FSG.ET.KIWP.VY...F.NKITPIQSKE | |
Retrocopy | IRQYKVVAKPVI*LWKSPGVLHHFSGMETDKIWP*VYI<IFLNKITPIQSKE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 25 .99 RPM |
SRP007412_cerebellum | 0 .00 RPM | 32 .95 RPM |
SRP007412_heart | 0 .00 RPM | 21 .76 RPM |
SRP007412_kidney | 0 .13 RPM | 108 .46 RPM |
SRP007412_liver | 0 .09 RPM | 16 .46 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4225 |
Pan troglodytes | retro_ptro_2870 |
Gorilla gorilla | retro_ggor_2829 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000016835 | 1 retrocopy | |
Homo sapiens | ENSG00000162433 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000026644 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000009622 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000001079 | 3 retrocopies | |
Mus musculus | ENSMUSG00000028527 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000015163 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000016024 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000010345 | 17 retrocopies | |
Pongo abelii | ENSPPYG00000001269 | 6 retrocopies |
retro_pabe_1021, retro_pabe_2479, retro_pabe_2735, retro_pabe_2970, retro_pabe_3412 , retro_pabe_3483,
|
Pongo abelii | ENSPPYG00000019245 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000000827 | 4 retrocopies |