RetrogeneDB ID: | retro_sscr_627 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 2:73879504..73879839(+) | ||
Located in intron of: | ENSSSCG00000013522 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSSCG00000015034 | ||
Aliases: | SDHD, CII-4, CybS, QPs3 | ||
Description: | Sus scrofa succinate dehydrogenase complex, subunit D, integral membrane protein (SDHD), nuclear gene encoding mitochondrial protein, mRNA. [Source:RefSeq mRNA;Acc:NM_001097516] |
Percent Identity: | 77.88 % |
Parental protein coverage: | 70.44 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MATLWRLSVLCGPRGGGALVLRTSVVRPAHVSAFLQDRHTPGWCGVQHIHLSPSHQASSKAASLHWTGER |
MATLWRLS.LCG...GGAL.L.T.VV.PAHVSAFL..R...GWCG.QHIHLSPSHQ..SKAASLHWTG.R | |
Retrocopy | MATLWRLSTLCGAQKGGALFL*TPVVKPAHVSAFLRSRPSGGWCGMQHIHLSPSHQSDSKAASLHWTGKR |
Parental | VVSVLLLGLLPAAYLNPCSAMDYSLAAALTLH-GHWGIGQVVT |
.VSVLLLGL.PAAYLNPCSAMDY.LA.ALTLH..HW..GQVVT | |
Retrocopy | AVSVLLLGLFPAAYLNPCSAMDYPLATALTLH<CHWDTGQVVT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 47 .92 RPM |
SRP014902_testis | 0 .00 RPM | 37 .62 RPM |
SRP018288_heart | 0 .00 RPM | 234 .72 RPM |
SRP018288_kidney | 0 .00 RPM | 260 .25 RPM |
SRP018288_liver | 0 .00 RPM | 149 .84 RPM |
SRP018288_lung | 0 .10 RPM | 34 .42 RPM |
SRP018856_adipose | 0 .00 RPM | 112 .71 RPM |
SRP035408_brain | 0 .00 RPM | 58 .88 RPM |
SRP035408_liver | 0 .00 RPM | 114 .78 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004066 | 3 retrocopies | |
Erinaceus europaeus | ENSEEUG00000013091 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000008424 | 1 retrocopy | |
Felis catus | ENSFCAG00000022580 | 3 retrocopies | |
Homo sapiens | ENSG00000204370 | 8 retrocopies | |
Gorilla gorilla | ENSGGOG00000026496 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000002763 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000012228 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000015247 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000022980 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000015034 | 3 retrocopies |
retro_sscr_1060, retro_sscr_626, retro_sscr_627 ,
|
Tursiops truncatus | ENSTTRG00000010520 | 5 retrocopies |