RetrogeneDB ID: | retro_sscr_701 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | 3:48911523..48911949(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSSSCG00000011637 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 66. % |
Parental protein coverage: | 76.44 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | SGAARAASGSSGAASAAGGGAGAG--ARPGDGG-TTAAAGPGPATKALTKEEDEWKDF-EQKEVDYSGLR |
SG...A.S...G.A......A..G..A..GD...TT..AGP.P.TKALTKEEDEWKDF.EQK.V.Y.GLR | |
Retrocopy | SGSSQASSLVGGWAVGHAHSAWLGDCANIGDAR<TTGDAGPRPTTKALTKEEDEWKDF>EQKDVGYTGLR |
Parental | VQAMQISEKEEDENEKREDPGDNWEEGGGGGGGVGVEKSSGPWNKTAPVQAPPAPVVVSETPEPTMTSGV |
VQAMQISEK..DEN.KREDPGD..EE.GGGG.G....KS...W.KTAPVQAPPA.VVVSETPEPT.TS.. | |
Retrocopy | VQAMQISEKK-DENGKREDPGDE*EE-GGGGEG----KSFRQWKKTAPVQAPPASVVVSETPEPTVTSSR |
Parental | YRPPGARLTT |
YRPPG.RLTT | |
Retrocopy | YRPPGTRLTT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 1 .86 RPM |
SRP014902_testis | 0 .00 RPM | 4 .10 RPM |
SRP018288_heart | 0 .00 RPM | 5 .19 RPM |
SRP018288_kidney | 0 .00 RPM | 10 .84 RPM |
SRP018288_liver | 0 .00 RPM | 8 .00 RPM |
SRP018288_lung | 0 .00 RPM | 1 .53 RPM |
SRP018856_adipose | 0 .00 RPM | 20 .58 RPM |
SRP035408_brain | 0 .00 RPM | 19 .56 RPM |
SRP035408_liver | 0 .00 RPM | 9 .69 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000035556 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000008963 | 5 retrocopies | |
Callithrix jacchus | ENSCJAG00000002998 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000010208 | 5 retrocopies | |
Equus caballus | ENSECAG00000015689 | 2 retrocopies | |
Homo sapiens | ENSG00000091527 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027821 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009864 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032803 | 10 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003470 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000012748 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000003600 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000025898 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000015409 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011637 | 1 retrocopy |
retro_sscr_701 ,
|
Tupaia belangeri | ENSTBEG00000014910 | 5 retrocopies | |
Tarsius syrichta | ENSTSYG00000011401 | 2 retrocopies |