RetrogeneDB ID: | retro_btau_638 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 16:9705338..9705617(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PTP4A2 | ||
Ensembl ID: | ENSBTAG00000039121 | ||
Aliases: | PTP4A2, PTP4A3 | ||
Description: | protein tyrosine phosphatase type IVA 3 [Source:RefSeq peptide;Acc:NP_001098468] |
Percent Identity: | 69.47 % |
Parental protein coverage: | 52.1 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | WLNLLK-TKFREEPGCCVAVHCVAGLGRA--PVLVALA----LIECGMKYEDAVQFIRQ-KRRGAFNSKQ |
WL.LLK.TK..EE.GCCV..HCVAGLGR...PV..AL.....L.E..M..EDA.QFIRQ.KRRGAFNSKQ | |
Retrocopy | WLSLLK<TKYPEEQGCCVVAHCVAGLGRGPVPVALALIECGMLNEVHMWNEDAFQFIRQ>KRRGAFNSKQ |
Parental | LLYLEKYRPKMRLRFRDTNGHCCVQ |
LLYLEKY.PKM.L.FRDTN.H.CVQ | |
Retrocopy | LLYLEKYQPKM*LCFRDTNRHYCVQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 95 .53 RPM |
ERP005899_muscle | 0 .00 RPM | 128 .12 RPM |
SRP017611_brain | 0 .00 RPM | 77 .88 RPM |
SRP017611_kidney | 0 .00 RPM | 89 .09 RPM |
SRP017611_liver | 0 .00 RPM | 83 .44 RPM |
SRP030211_testis | 0 .01 RPM | 63 .08 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000002275 | 3 retrocopies | |
Bos taurus | ENSBTAG00000039121 | 1 retrocopy |
retro_btau_638 ,
|
Bos taurus | ENSBTAG00000046467 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000006539 | 2 retrocopies | |
Homo sapiens | ENSG00000184007 | 4 retrocopies | |
Mus musculus | ENSMUSG00000028788 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000002137 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000002060 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000029603 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001606 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000050044 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000003605 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000002775 | 2 retrocopies | |
Tupaia belangeri | ENSTBEG00000006790 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000016571 | 2 retrocopies |